GuidelineCirculation2014
2013 AHA/ACC/TOS guideline for the management of overweight and obesity in adults: a report of the American College of Cardiology/American Heart Association Task Force on Practice Guidelines and The Obesity Society.
Erratum issued 11 registry-linked trialsAbstract readPractice Guideline
In one paragraph
Guideline in Circulation, 2014. The graph could read no effect estimate from its abstract, so it casts no vote on the map. An erratum has been issued. It is linked to 11 registered trials, which are not on this map. Cited by 1,409 papers, 12 of them syntheses that pooled it.
0numbers the graph read from it
0cells of the map it votes in
1,409citing papers in PubMed, 12 pooled it
–field-weighted citation impact
What it found
Each row is one number read from the abstract, on the scale the paper reported it, with its interval. Left of the dashed line favours the treatment, right favours the comparator. Under each row is the sentence it came from. New to these charts? A ten-minute tutorial.
The abstract states no effect estimate the extractor could read, or names no intervention and outcome on the map, so this paper lights no cell and moves no belief. It is still indexed, cited and linked below.
The trial behind it
Trials whose registry record cites this paper, or whose number appears in the abstract. A trial that started after this paper was published is citing it as background, not reporting it.
Synergy Effect of the Appetite Hormone GLP-1 (LiragluTide) and Exercise on Maintenance of Weight Loss and Health After a Low Calorie Diet - the S-LiTE Randomized Trial
PMID 23186644PMID 26132939PMID 26284720PMID 28049736PMID 30052921PMID 27295427PMID 27633186PMID 25287751PMID 23812094PMID 26916363PMID 11234459PMID 11684524other papers from this trial
Open the trial in the graphThe Effect of Addition of Metformin In Obese Non- Diabetic Patients With Heart Failure With Preserved Ejection Fraction
Open the trial in the graphEfficacy and Safety of American Ginseng (Penax Quinquefolius) Extract on Glycemic Control in Individuals With Type 2 Diabetes: A Double-blind, Randomized, Crossover Clinical Trial
What is the Effect of a Feedback Device on Weight Loss and Metabolic Measurements in Obese People With the Metabolic Syndrome?
The Use of a Virtual Weight Management Program for Prescription of Phentermine in Patients With Overweight or Obesity Compared to Standard Face to Face Visits
A Retrospective Study to Evaluate the Effectiveness of a Comprehensive Visceral Adiposity-Focused Anti-Obesity Program
Effects of Intensive Lifestyle Interventions (ILI) on Weight Loss and Cardiometabolic Risks in Obese Adults With Metabolic Syndrome: A Randomized Clinical Trial
NCT06379802 naactive not recruitingnot on this mapstarted 2024, after this paper: background citation
Lifestyle Intervention With Physical Activity and Diet for Precision Health in Individuals With Overweight: a 6-month Pilot Randomized Controlled Trial (LI-PAD)
Efficacy and Safety of X A-DERM™ Microsurfaced Acellular Dermal Matrix (mADM) for Enhancing Wound Healing Following Mohs Micrographic Surgery (MMS)
Impact of Intermittent Fasting on Sleep and Quality of Life Among Healthy Adults
Targeting Metabolic Syndrome From the Emergency Department Through Mixed-Methods: Pilot Trial
Who cites it
1,409 citing papers in PubMed, 12 syntheses or guidelines pooled it.
- Attenuation of Adaptive Thermogenesis by a Culinary Dose of Red Pepper During 24-Hour Negative Energy Balance.Nutrition reviews · 2026Pooled it
- Joint TOS/OMA/OAC Expert Guidance Statement on the Pharmacological Management of United States Adults With Overweight or Obesity Using the GRADE Approach.Obesity (Silver Spring, Md.) · 2026Guideline
- iCARDIO Alliance Global Implementation Guidelines for the Management of Obesity 2025.Journal of cachexia, sarcopenia and muscle · 2026Guideline
- Effect of Nordic Walking on Anthropometrics, Glycemia, and Lipid Profile in Adults With Prediabetes or Diabetes: A Systematic Review and Meta-Analysis of Randomized Controlled Trials.Journal of diabetes research · 2026Pooled it
- The effects of detraining on body composition and cardiometabolic health: a systematic review and meta-analysis of randomized controlled trials.Frontiers in physiology · 2026Pooled it
- Continuous aerobic exercise and atherosclerosis-related vascular indices in overweight and obese adults: a Bayesian three-level meta-analysis of randomized controlled trials.Frontiers in physiology · 2026Pooled it
- From passive monitoring to active engagement: a systematic review and meta-analysis of digital health technologies for improving objective physical activity and cardiorespiratory fitness in patients with obstructive sleep apnea.Frontiers in public health · 2026Pooled it
- The interplay between the adrenergic system and obesity: a systematic review.International journal of obesity (2005) · 2025Pooled it
- Efficiency of time-restricted eating and energy restriction on anthropometrics and body composition in adults: a systematic review and meta-analysis of randomized controlled trials.The international journal of behavioral nutrition and physical activity · 2025Pooled it
- The Prevalence of Eating Disorders and Disordered Eating in Adults Seeking Obesity Treatment: A Systematic Review With Meta-Analyses.The International journal of eating disorders · 2025Pooled it
- Impact of serum lipids on prognosis in breast cancer patients: a systematic review and meta-analysis.World journal of surgical oncology · 2025Pooled it
- Automated lifestyle interventions and weight loss: a systematic review of randomized controlled trials.International journal of obesity (2005) · 2025Pooled it
- Trial
- Virtual Weight Management and Continuous Glucose Monitoring in Patients With Type 2 Diabetes: A Randomized Controlled Trial.Obesity (Silver Spring, Md.) · 2026Trial
- Associations among pork intake, weight-loss, and diet quality outcomes in a commercial weight-management program.Nutrition & diabetes · 2026Trial
- Effects of a 2-Year Primary Care Weight Loss Intervention on Quality of Life in Patients With Obesity.Obesity (Silver Spring, Md.) · 2026Trial
- Eating frequency, timing of meals, and sleep duration before and after a randomized controlled weight loss trial for breast cancer survivors.Journal of cancer survivorship : research and practice · 2026Trial
- Enhanced Weight Management Program for Veterans With Posttraumatic Stress Disorder: A Randomized Clinical Trial.JAMA network open · 2026Trial
- Setmelanotide in Bardet-Biedl Syndrome: A 52-Week Comparison of Phase 3 Trial Participants With a Matched Registry Cohort.Obesity (Silver Spring, Md.) · 2026Trial
- Effect of protein supplementation on hip bone mineral density, cortical thickness, and bone strength in older adult participants during a caloric restriction and aerobic exercise weight loss intervention: a randomized controlled trial.Osteoporosis international : a journal established as result of cooperation between the European Foundation for Osteoporosis and the National Osteoporosis Foundation of the USA · 2026Trial
1,349 more citing papers are in PubMed but not listed here.
Corrections and comments
- Erratum issued
Authors and funding
43 authors.
Michael D Jensen
Donna H Ryan
Caroline M Apovian
Jamy D Ard
Anthony G Comuzzie
Karen A Donato
Frank B Hu
Van S Hubbard
John M Jakicic
Robert F Kushner
Catherine M Loria
Barbara E Millen
Cathy A Nonas
F Xavier Pi-Sunyer
June Stevens
Victor J Stevens
Thomas A Wadden
Bruce M Wolfe
Susan Z Yanovski
Harmon S Jordan
Karima A Kendall
Linda J Lux
Roycelynn Mentor-Marcel
Laura C Morgan
Michael G Trisolini
Janusz Wnek
Jeffrey L Anderson
Jonathan L Halperin
Nancy M Albert
Biykem Bozkurt
Ralph G Brindis
Lesley H Curtis
David DeMets
Judith S Hochman
Richard J Kovacs
E Magnus Ohman
Susan J Pressler
Frank W Sellke
Win-Kuang Shen
Sidney C Smith
Gordon F Tomaselli
American College of Cardiology/American Heart Association Task Force on Practice Guidelines
Obesity Society
Funding
RESEARCH TRAININGP30DK026687 · ST. LUKE'S-ROOSEVELT INST FOR HLTH SCIS · 1986 to 2025
$7.5MSIGNAL TRANSDUCTION IN HUMAN ABDOMINAL AND GLUTEOFEMORAL ADIPOCYTESP30DK046200 · TUFTS MEDICAL CENTER · 1992 to 2005
$5.3MNIDDK NIH HHS P30 DK026687NIDDK NIH HHS P30 DK046200
Abstract
PubMed holds no abstract for this paper.
Indexed as
Disease ManagementAmerican Heart AssociationDiet, ReducingHumansLife StyleMotor ActivityObesityOverweightUnited StatesWeight Reduction ProgramsAHA Scientific Statementsbariatric surgerybehavior therapyblood pressurebody mass indexdiabetes mellitusdietdyslipidemialifestylewaist circumferenceweight loss
Identifiers
What Socratic holds
Textmetadata
LicenceCC BY-NC-ND
Read underepoch 390
Registered trials
NCT04122716ClinicalTrials.gov
NCT05847244ClinicalTrials.gov
NCT02923453ClinicalTrials.gov
NCT03491930ClinicalTrials.gov
NCT04614545ClinicalTrials.gov
NCT04807959ClinicalTrials.gov
and 5 more above
Read under generation 80e0d062 · epoch 390. Bibliography from PubMed, PubMed Central and OpenAlex; grants from NIH RePORTER; trial links from ClinicalTrials.gov; estimates, votes and beliefs from the Socratic graph.