Evidence mapPaperPMID 32059053Full record

SynthesisAdvances in nutrition (Bethesda, Md.)2020

Effects of Popular Diets on Anthropometric and Cardiometabolic Parameters: An Umbrella Review of Meta-Analyses of Randomized Controlled Trials.

Monica Dinu, Giuditta Pagliai, Donato Angelino, Alice Rosi, Margherita Dall'Asta, Letizia Bresciani, Cinzia Ferraris, Monica Guglielmetti, Justyna Godos, Cristian Del Bo' and 5 more

Abstract readSystematic Review
In one paragraph

Synthesis in Advances in nutrition (Bethesda, Md.), 2020. The graph could read no effect estimate from its abstract, so it casts no vote on the map. Cited by 81 papers, 13 of them syntheses that pooled it.

0numbers the graph read from it
0cells of the map it votes in
81citing papers in PubMed, 13 pooled it
field-weighted citation impact
1 · What the graph read from it

What it found

Each row is one number read from the abstract, on the scale the paper reported it, with its interval. Left of the dashed line favours the treatment, right favours the comparator. Under each row is the sentence it came from. New to these charts? A ten-minute tutorial.

The abstract states no effect estimate the extractor could read, or names no intervention and outcome on the map, so this paper lights no cell and moves no belief. It is still indexed, cited and linked below.

2 · The registry

The trial behind it

Trials whose registry record cites this paper, or whose number appears in the abstract. A trial that started after this paper was published is citing it as background, not reporting it.

Neither the registry nor the abstract names a trial number. If this is a trial report, that itself is worth knowing.

3 · Its place in the literature

Who cites it

81 citing papers in PubMed, 13 syntheses or guidelines pooled it.

  1. Pooled it
  2. Pooled it
  3. Pooled it
  4. Pooled it
  5. Pooled it
  6. Pooled it
  7. Pooled it
  8. Pooled it
  9. Pooled it
  10. Adherence to Mediterranean Diet and Risk of Pancreatic Cancer: Systematic Review and Meta-Analysis.International journal of environmental research and public health · 2023
    Pooled it
  11. Diets, Dietary Patterns, Single Foods and Pancreatic Cancer Risk: An Umbrella Review of Meta-Analyses.International journal of environmental research and public health · 2022
    Pooled it
  12. Pooled it
  13. Pooled it
  14. Trial
  15. Trial
  16. Trial
  17. Trial
  18. Review
  19. Article
  20. Article

21 more citing papers are in PubMed but not listed here.

4 · The record

Corrections and comments

PubMed lists nothing against this paper. Absence here is not a guarantee, only a check that was made.

5 · Who and what money

Authors and funding

15 authors.

Monica DinuDepartment of Experimental and Clinical Medicine, University of Florence, Florence, Italy.
Giuditta PagliaiDepartment of Experimental and Clinical Medicine, University of Florence, Florence, Italy.
Donato AngelinoFaculty of Bioscience and Technology for Food, Agriculture, and Environment, University of Teramo, Teramo, Italy.
Alice RosiHuman Nutrition Unit, Department of Food and Drug, University of Parma, Parma, Italy.
Margherita Dall'AstaDepartment of Animal Science, Food, and Nutrition, Università Cattolica del Sacro Cuore, Piacenza, Italy.
Letizia BrescianiHuman Nutrition Unit, Department of Veterinary Science, University of Parma, Parma, Italy.
Cinzia FerrarisHuman Nutrition and Eating Disorder Research Center, Department of Public Health, Experimental and Forensic Medicine, University of Pavia, Pavia, Italy.
Monica GuglielmettiHuman Nutrition and Eating Disorder Research Center, Department of Public Health, Experimental and Forensic Medicine, University of Pavia, Pavia, Italy.
Justyna GodosOasi Research Institute, Troina, Italy.
Cristian Del Bo'Department of Food, Environmental, and Nutritional Sciences, Università degli Studi di Milano, Milan, Italy.
Daniele NucciDigestive Endoscopy Unit, Veneto Institute of Oncology, Padua, Italy.
Erika MeroniDepartment of Food, Environmental, and Nutritional Sciences, Università degli Studi di Milano, Milan, Italy.
Linda LandiniMedical Affairs Janssen, Cologno-Monzese, Milan, Italy.
Daniela MartiniDepartment of Food, Environmental, and Nutritional Sciences, Università degli Studi di Milano, Milan, Italy.
Francesco SofiDepartment of Experimental and Clinical Medicine, University of Florence, Florence, Italy.

Funding

No grant is acknowledged in the PubMed record.

6 · The paper itself

Abstract

The prevalence of overweight, obesity, and their related complications is increasing worldwide. The purpose of this umbrella review was to summarize and critically evaluate the effects of different diets on anthropometric parameters and cardiometabolic risk factors. Medline, Embase, Scopus, Cochrane Database of Systematic Reviews, and Web of Science, from inception to April 2019, were used as data sources to select meta-analyses of randomized controlled trials that examined the effects of different diets on anthropometric parameters and cardiometabolic risk factors. Strength and validity of the evidence were assessed through a set of predefined criteria. Eighty articles reporting 495 unique meta-analyses were examined, covering a wide range of popular diets: low-carbohydrate (n = 21 articles), high-protein (n = 8), low-fat (n = 9), paleolithic (n = 2), low-glycemic-index/load (n = 12), intermittent energy restriction (n = 6), Mediterranean (n = 11), Nordic (n = 2), vegetarian (n = 9), Dietary Approaches to Stop Hypertension (DASH) (n = 6), and portfolio dietary pattern (n = 1). Great variability in terms of definition of the intervention and control diets was observed. The methodological quality of most articles (n = 65; 81%), evaluated using the "A MeaSurement Tool to Assess systematic Reviews-2" questionnaire, was low or critically low. The strength of evidence was generally weak. The most consistent evidence was reported for the Mediterranean diet, with suggestive evidence of an improvement in weight, BMI, total cholesterol, glucose, and blood pressure. Suggestive evidence of an improvement in weight and blood pressure was also reported for the DASH diet. Low-carbohydrate, high-protein, low-fat, and low-glycemic-index/load diets showed suggestive and/or weak evidence of a reduction in weight and BMI, but contrasting evidence for lipid, glycemic, and blood pressure parameters, suggesting potential risks of unfavorable effects. Evidence for paleolithic, intermittent energy restriction, Nordic, vegetarian, and portfolio dietary patterns was graded as weak. Among all the diets evaluated, the Mediterranean diet had the strongest and most consistent evidence of a beneficial effect on both anthropometric parameters and cardiometabolic risk factors. This review protocol was registered at www.crd.york.ac.uk/PROSPERO/ as CRD42019126103.

Indexed as

Cardiovascular DiseasesDietary Approaches To Stop HypertensionDiet, MediterraneanGlycemic IndexHumansMeta-Analysis as TopicRandomized Controlled Trials as Topicdietmeta-analysisreviewrisk factorsweight

Identifiers

PMID32059053
PMCPMC7360456

What Socratic holds

Textmetadata
Read underepoch 390

Registered trials

None linked

Read under generation 80e0d062 · epoch 390. Bibliography from PubMed, PubMed Central and OpenAlex; grants from NIH RePORTER; trial links from ClinicalTrials.gov; estimates, votes and beliefs from the Socratic graph.