Evidence map›Paper›PMID 41515216›Full record

ArticleNutrients2025

1-Deoxynojirimycin Combined with Theaflavins Targets PTGS2/MMP9 to Exert a Synergistic Hypoglycemic Effect.

Yuanyuan Wang, Chenyin Qu, Qiannan Di, Jingyi Zhang, Lixin Na

Abstract read
In one paragraph

Article in Nutrients, 2025. The graph could read no effect estimate from its abstract, so it casts no vote on the map. Cited by 2 papers.

0numbers the graph read from it
0cells of the map it votes in
2citing papers in PubMed
–field-weighted citation impact
1 · What the graph read from it

What it found

Each row is one number read from the abstract, on the scale the paper reported it, with its interval. Left of the dashed line favours the treatment, right favours the comparator. Under each row is the sentence it came from. New to these charts? A ten-minute tutorial.

The abstract states no effect estimate the extractor could read, or names no intervention and outcome on the map, so this paper lights no cell and moves no belief. It is still indexed, cited and linked below.

2 · The registry

The trial behind it

Trials whose registry record cites this paper, or whose number appears in the abstract. A trial that started after this paper was published is citing it as background, not reporting it.

Neither the registry nor the abstract names a trial number. If this is a trial report, that itself is worth knowing.

3 · Its place in the literature

Who cites it

2 citing papers in PubMed.

  1. Review
  2. Review
4 · The record

Corrections and comments

PubMed lists nothing against this paper. Absence here is not a guarantee, only a check that was made.

5 · Who and what money

Authors and funding

5 authors.

Yuanyuan WangThe College of Public Health, Shanghai University of Medicine & Health Sciences, 279 Zhouzhu Road, Pudong New Area, Shanghai 201318, China.ORCID 0000-0001-5086-3777
Chenyin QuThe College of Public Health, Shanghai University of Medicine & Health Sciences, 279 Zhouzhu Road, Pudong New Area, Shanghai 201318, China.
Qiannan DiThe College of Public Health, Shanghai University of Medicine & Health Sciences, 279 Zhouzhu Road, Pudong New Area, Shanghai 201318, China.
Jingyi ZhangThe College of Public Health, Shanghai University of Medicine & Health Sciences, 279 Zhouzhu Road, Pudong New Area, Shanghai 201318, China.
Lixin NaThe College of Public Health, Shanghai University of Medicine & Health Sciences, 279 Zhouzhu Road, Pudong New Area, Shanghai 201318, China.

Funding

Shanghai Natural Science Foundation General Program 25ZR1401165
6 · The paper itself

Abstract

PubMed holds no abstract for this paper.

Indexed as

1-DeoxynojirimycinBiflavonoidsCatechinCyclooxygenase 2Diabetes Mellitus, Type 2Hypoglycemic AgentsMatrix Metalloproteinase 9alpha-AmylasesAnimalsDiet, High-FatDrug SynergismGlycoside Hydrolase InhibitorsHep G2 CellsHumansInsulin ResistanceMale1-Deoxynojirimycinalpha-AmylasesBiflavonoidsCatechinCyclooxygenase 2Glycoside Hydrolase InhibitorsHypoglycemic AgentsMatrix Metalloproteinase 9Ptgs2 protein, mousetheaflavin1-deoxynojirimycinsynergistictheaflavinstype 2 diabetes mellitus (T2DM)

Identifiers

PMID41515216
PMCPMC12787591

What Socratic holds

Textmetadata
LicenceCC BY
Read underepoch 390

Registered trials

None linked

Read under generation 80e0d062 · epoch 390. Bibliography from PubMed, PubMed Central and OpenAlex; grants from NIH RePORTER; trial links from ClinicalTrials.gov; estimates, votes and beliefs from the Socratic graph.